ARRB1

ARRB1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

2IV8

Ідентифікатори
Символи ARRB1, ARB1, ARR1, Arrestin beta 1
Зовнішні ІД OMIM: 107940 MGI: 99473 HomoloGene: 2981 GeneCards: ARRB1
Онтологія гена
Молекулярна функція

• GO:0005097, GO:0005099, GO:0005100 GTPase activator activity
• histone acetyltransferase activity
• GO:0048551 enzyme inhibitor activity
• insulin-like growth factor receptor binding
• transcription factor binding
• mitogen-activated protein kinase kinase binding
• clathrin adaptor activity
• protein phosphorylated amino acid binding
• cysteine-type endopeptidase inhibitor activity involved in apoptotic process
• GO:0001948, GO:0016582 protein binding
• AP-2 adaptor complex binding
• alpha-1B adrenergic receptor binding
• Зв'язування з рецептором вазопресину V2
• phosphoprotein binding
• angiotensin receptor binding
• ubiquitin protein ligase binding
• arrestin family protein binding
• signaling receptor binding
• enzyme binding
• estrogen receptor binding
• alpha-1A adrenergic receptor binding
• follicle-stimulating hormone receptor binding
• transmembrane transporter binding
• clathrin binding
• G protein-coupled receptor binding

Клітинна компонента

• цитоплазма
• гіалоплазма
• postsynaptic membrane
• мембрана
• клітинне ядро
• cell projection
• dendritic spine
• heterotrimeric G-protein complex
• Хроматин
• клітинна мембрана
• внутрішньоклітинний
• нуклеоплазма
• clathrin-coated pit
• Псевдоподія
• GO:0097483, GO:0097481 постсинаптичне ущільнення
• Golgi membrane
• lysosomal membrane
• basolateral plasma membrane
• cytoplasmic vesicle membrane
• GO:0016023 cytoplasmic vesicle
• ядерні тільця
• ендосома

Біологічний процес

• positive regulation of Rho protein signal transduction
• regulation of G protein-coupled receptor signaling pathway
• positive regulation of receptor internalization
• transcription by RNA polymerase II
• stress fiber assembly
• follicle-stimulating hormone signaling pathway
• platelet activation
• positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
• GO:0034259 negative regulation of GTPase activity
• positive regulation of ERK1 and ERK2 cascade
• positive regulation of insulin secretion involved in cellular response to glucose stimulus
• proteasome-mediated ubiquitin-dependent protein catabolic process
• phototransduction
• GO:0009373 regulation of transcription, DNA-templated
• transcription, DNA-templated
• positive regulation of peptidyl-serine phosphorylation
• negative regulation of interleukin-8 production
• Убіквітин-залежний протеоліз
• protein transport
• GO:0033128 negative regulation of protein phosphorylation
• positive regulation of smooth muscle cell apoptotic process
• positive regulation of histone H4 acetylation
• positive regulation of protein binding
• negative regulation of NF-kappaB transcription factor activity
• positive regulation of protein ubiquitination
• G protein-coupled receptor internalization
• negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
• ендоцитоз
• negative regulation of interleukin-6 production
• positive regulation of histone acetylation
• negative regulation of protein ubiquitination
• negative regulation of ERK1 and ERK2 cascade
• negative regulation of signal transduction
• GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
• GO:0072468 сигнальна трансдукція
• GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
• GO:0097285 апоптоз
• membrane organization
• regulation of apoptotic process
• ubiquitin-dependent protein catabolic process
• negative regulation of Notch signaling pathway
• G protein-coupled receptor signaling pathway
• positive regulation of protein phosphorylation
• positive regulation of cell population proliferation
• negative regulation of apoptotic process
• GO:1904089 negative regulation of neuron apoptotic process
• histone acetylation

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
408
109689
Ensembl
ENSG00000137486
ENSMUSG00000018909
UniProt
P49407
Q8BWG8
RefSeq (мРНК)
NM_004041
NM_020251
NM_177231
NM_178220
RefSeq (білок)
NP_004032
NP_064647
NP_796205
NP_835738
Локус (UCSC) Хр. 11: 75.26 – 75.35 Mb Хр. 7: 99.18 – 99.26 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARRB1 (англ. Arrestin beta 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 418 амінокислот, а молекулярна маса — 47 066[4].

Послідовність амінокислот
1020304050
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKE
RRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL
QERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFC
AENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLE
ASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYK
CPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFT
LMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMK
DDKEEEEDGTGSPQLNNR

Кодований геном білок за функціями належить до фосфопротеїнів, інгібіторів передачі внутрішньоклітинних сигналів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, транспорт, транспорт білків, альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані, клатрин-вкритих заглибинах мембрани, клітинних відростках, цитоплазматичних везикулах.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Kovoor A., Celver J., Abdryashitov R.I., Chavkin C., Gurevich V.V. (1999). Targeted construction of phosphorylation-independent beta-arrestin mutants with constitutive activity in cells. J. Biol. Chem. 274: 6831—6834. PMID 10066734 DOI:10.1074/jbc.274.11.6831
  • Oakley R.H., Laporte S.A., Holt J.A., Caron M.G., Barak L.S. (2000). Differential affinities of visual arrestin, beta arrestin1, and beta arrestin2 for G protein-coupled receptors delineate two major classes of receptors. J. Biol. Chem. 275: 17201—17210. PMID 10748214 DOI:10.1074/jbc.M910348199
  • Braun L., Christophe T., Boulay F. (2003). Phosphorylation of key serine residues is required for internalization of the complement 5a (C5a) anaphylatoxin receptor via a beta-arrestin, dynamin, and clathrin-dependent pathway. J. Biol. Chem. 278: 4277—4285. PMID 12464600 DOI:10.1074/jbc.M210120200
  • Ahn S., Wei H., Garrison T.R., Lefkowitz R.J. (2004). Reciprocal regulation of angiotensin receptor-activated extracellular signal-regulated kinases by beta-arrestins 1 and 2. J. Biol. Chem. 279: 7807—7811. PMID 14711824 DOI:10.1074/jbc.C300443200
  • Huettenrauch F., Pollok-Kopp B., Oppermann M. (2005). G protein-coupled receptor kinases promote phosphorylation and beta-arrestin-mediated internalization of CCR5 homo- and hetero-oligomers. J. Biol. Chem. 280: 37503—37515. PMID 16144840 DOI:10.1074/jbc.M500535200

Примітки

  1. ↑ Human PubMed Reference:.
  2. ↑ Mouse PubMed Reference:.
  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:711 (англ.) . Процитовано 8 вересня 2017.
  4. ↑ UniProt, P49407 (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 8 вересня 2017.

Див. також

  • Хромосома 11
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.