CD3E

CD3E
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1A81, 1SY6, 1XIW, 2ROL

Ідентифікатори
Символи CD3E, IMD18, T3E, TCRE, CD3e molecule, CD3epsilon, CD3 epsilon subunit of T-cell receptor complex
Зовнішні ІД OMIM: 186830 MGI: 88332 HomoloGene: 586 GeneCards: CD3E
Пов'язані генетичні захворювання
CD3delta deficiency[1]
Онтологія гена
Молекулярна функція

SH3 domain binding
signal transducer activity
GO:0001948, GO:0016582 protein binding
protein heterodimerization activity
signaling receptor complex adaptor activity
T cell receptor binding
protein kinase binding
transmembrane signaling receptor activity
protein homodimerization activity

Клітинна компонента

integral component of membrane
мембрана
cell-cell junction
alpha-beta T cell receptor complex
клітинна мембрана
integral component of plasma membrane
T cell receptor complex
immunological synapse
external side of plasma membrane
dendritic spine
cell body

Біологічний процес

regulation of apoptotic process
G protein-coupled receptor signaling pathway
positive regulation of calcium-mediated signaling
negative regulation of smoothened signaling pathway
T cell differentiation in thymus
response to nutrient
transmembrane receptor protein tyrosine kinase signaling pathway
процес імунної системи
T cell costimulation
positive regulation of interferon-gamma production
signal complex assembly
negative regulation of gene expression
positive regulation of interleukin-4 production
negative thymic T cell selection
cell surface receptor signaling pathway
GO:1901313 positive regulation of gene expression
positive regulation of T cell anergy
positive regulation of T cell activation
positive regulation of T cell proliferation
positive regulation of alpha-beta T cell proliferation
positive regulation of peptidyl-tyrosine phosphorylation
regulation of immune response
apoptotic signaling pathway
lymphocyte activation
T cell receptor signaling pathway
T cell activation
protein homooligomerization
dendrite development
cerebellum development
адаптивна імунна відповідь
GO:0034622 protein-containing complex assembly
positive regulation of cell-matrix adhesion
T cell differentiation
positive regulation of cell-cell adhesion mediated by integrin
positive thymic T cell selection

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
916
12501
Ensembl
ENSG00000198851
ENSMUSG00000032093
UniProt
P07766
P22646
RefSeq (мРНК)
NM_000733
NM_007648
RefSeq (білок)
NP_000724
NP_031674
Локус (UCSC) Хр. 11: 118.3 – 118.32 Mb Хр. 9: 44.91 – 44.92 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CD3E (англ. CD3e molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 207 амінокислот, а молекулярна маса — 23 147[5].

Послідовність амінокислот
1020304050
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCP
QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP
RGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYY
WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYS
GLNQRRI

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у такому біологічному процесі, як імунітет. Локалізований у клітинній мембрані, мембрані.

Література

  • Clevers H.C., Dunlap S., Wileman T.E., Terhorst C. (1988). Human CD3-epsilon gene contains three miniexons and is transcribed from a non-TATA promoter. Proc. Natl. Acad. Sci. U.S.A. 85: 8156—8160. PMID 3267235 DOI:10.1073/pnas.85.21.8156
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Soudais C., de Villartay J.P., Le Deist F., Fischer A., Lisowska-Grospierre B. (1993). Independent mutations of the human CD3-epsilon gene resulting in a T cell receptor/CD3 complex immunodeficiency. Nat. Genet. 3: 77—81. PMID 8490660 DOI:10.1038/ng0193-77
  • Fuetterer K., Wong J., Grucza R.A., Chan A.C., Waksman G. (1998). Structural basis for Syk tyrosine kinase ubiquity in signal transduction pathways revealed by the crystal structure of its regulatory SH2 domains bound to a dually phosphorylated ITAM peptide. J. Mol. Biol. 281: 523—537. PMID 9698567 DOI:10.1006/jmbi.1998.1964
  • Arnett K.L., Harrison S.C., Wiley D.C. (2004). Crystal structure of a human CD3-epsilon/delta dimer in complex with a UCHT1 single-chain antibody fragment. Proc. Natl. Acad. Sci. U.S.A. 101: 16268—16273. PMID 15534202 DOI:10.1073/pnas.0407359101

Примітки

  1. Захворювання, генетично пов'язані з CD3E переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:1674 (англ.) . Процитовано 8 вересня 2017.
  5. UniProt, P07766 (англ.) . Архів оригіналу за 30 серпня 2017. Процитовано 8 вересня 2017.

Див. також

  • Хромосома 11
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

  • п
  • о
  • р
Білки: кластери диференціації
1-5051-100101-150151-200201-250251-300301-350