HDAC2

HDAC2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

3MAX, 4LXZ, 4LY1

Ідентифікатори
Символи HDAC2, HD2, RPD3, YAF1, histone deacetylase 2, KDAC2
Зовнішні ІД OMIM: 605164 MGI: 1097691 HomoloGene: 68187 GeneCards: HDAC2
Реагує на сполуку
apicidin, belinostat, Масляна кислота, entinostat, givinostat, mocetinostat, panobinostat, quisinostat, romidepsin, trichostatin A, золінза, Viroporin 3a[1]
Онтологія гена
Молекулярна функція

nucleosomal DNA binding
heat shock protein binding
transcription factor binding
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
enzyme binding
NAD-dependent histone deacetylase activity (H3-K14 specific)
protein deacetylase activity
chromatin binding
NF-kappaB binding
GO:0001948, GO:0016582 protein binding
sequence-specific DNA binding
hydrolase activity
histone deacetylase activity
RNA binding
histone deacetylase binding
deacetylase activity
promoter-specific chromatin binding

Клітинна компонента

цитоплазма
клітинне ядро
NuRD complex
ESC/E(Z) complex
Sin3 complex
Хроматин
нуклеоплазма
histone deacetylase complex
GO:0009327 protein-containing complex
Sin3-type complex
мембрана
integral component of membrane

Біологічний процес

cellular response to retinoic acid
cellular response to heat
ритмічний процес
response to amphetamine
negative regulation of DNA binding
cardiac muscle hypertrophy
odontogenesis of dentin-containing tooth
positive regulation of proteolysis
positive regulation of interleukin-1 production
response to cocaine
cellular response to transforming growth factor beta stimulus
positive regulation of collagen biosynthetic process
histone H3 deacetylation
ремоделювання хроматину
negative regulation of peptidyl-lysine acetylation
GO:0009373 regulation of transcription, DNA-templated
response to nicotine
embryonic digit morphogenesis
negative regulation of MHC class II biosynthetic process
negative regulation of DNA-binding transcription factor activity
transcription, DNA-templated
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
histone H4 deacetylation
fungiform papilla formation
positive regulation of tumor necrosis factor production
response to caffeine
negative regulation of dendritic spine development
hair follicle placode formation
epidermal cell differentiation
positive regulation of oligodendrocyte differentiation
negative regulation of neuron projection development
response to hyperoxia
dendrite development
negative regulation of apoptotic process
GO:1901227 negative regulation of transcription by RNA polymerase II
eyelid development in camera-type eye
positive regulation of epithelial to mesenchymal transition
circadian regulation of gene expression
response to lipopolysaccharide
behavioral response to ethanol
GO:0045996 negative regulation of transcription, DNA-templated
cellular response to dopamine
зсідання крові
positive regulation of cell population proliferation
histone deacetylation
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
cellular response to hydrogen peroxide
regulation of signal transduction by p53 class mediator
positive regulation of tyrosine phosphorylation of STAT protein
GO:0031497, GO:0006336, GO:0034724, GO:0001301, GO:0007580, GO:0034652, GO:0010847 chromatin organization
positive regulation of male mating behavior

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
3066
15182
Ensembl
ENSG00000196591
ENSMUSG00000019777
UniProt
Q92769
P70288
RefSeq (мРНК)
NM_001527
NM_008229
RefSeq (білок)
NP_001518
NP_032255
Локус (UCSC) Хр. 6: 113.93 – 114.01 Mb Хр. 10: 36.85 – 36.88 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HDAC2 (англ. Histone deacetylase 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 488 амінокислот, а молекулярна маса — 55 364[5].

Послідовність амінокислот
1020304050
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYR
KMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGED
CPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFH
KYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVM
EMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSN
MTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGE
DPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEED
KKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP

Кодований геном білок за функціями належить до репресорів, гідролаз, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, ацетилювання, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі.

Література

  • Yang W.-M., Inouye C.J., Zeng Y., Bearss D., Seto E. (1996). Transcriptional repression by YY1 is mediated by interaction with a mammalian homolog of the yeast global regulator RPD3. Proc. Natl. Acad. Sci. U.S.A. 93: 12845—12850. PMID 8917507 DOI:10.1073/pnas.93.23.12845
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Schmidt D.R., Schreiber S.L. (1999). Molecular association between ATR and two components of the nucleosome remodeling and deacetylating complex, HDAC2 and CHD4. Biochemistry. 38: 14711—14717. PMID 10545197 DOI:10.1021/bi991614n
  • Zhou S., Fujimuro M., Hsieh J.J., Chen L., Hayward S.D. (2000). A role for SKIP in EBNA2 activation of CBF1-repressed promoters. J. Virol. 74: 1939—1947. PMID 10644367 DOI:10.1128/JVI.74.4.1939-1947.2000
  • Rountree M.R., Bachman K.E., Baylin S.B. (2000). DNMT1 binds HDAC2 and a new co-repressor, DMAP1, to form a complex at replication foci. Nat. Genet. 25: 269—277. PMID 10888872 DOI:10.1038/77023
  • Ahringer J. (2000). NuRD and SIN3 histone deacetylase complexes in development. Trends Genet. 16: 351—356. PMID 10904264 DOI:10.1016/S0168-9525(00)02066-7

Примітки

  1. Сполуки, які фізично взаємодіють з histone deacetylase 2 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:4853 (англ.) . Архів оригіналу за 28 березня 2016. Процитовано 6 вересня 2017.
  5. UniProt, Q92769 (англ.) . Архів оригіналу за 1 вересня 2017. Процитовано 6 вересня 2017.

Див. також

  • Хромосома 6
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»