RAC1

RAC1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1E96, 1FOE, 1G4U, 1HE1, 1HH4, 1I4D, 1I4L, 1I4T, 1MH1, 1RYF, 1RYH, 2FJU, 2H7V, 2NZ8, 2P2L, 2RMK, 2VRW, 2WKP, 2WKQ, 2WKR, 2YIN, 3B13, 3BJI, 3RYT, 3SBD, 3SBE, 3SU8, 3SUA, 3TH5, 4GZL, 4GZM, 4YON, 5FI0

Ідентифікатори
Символи RAC1, MIG5, Rac-1, TC-25, p21-Rac1, ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1), Rac family small GTPase 1, MRD48
Зовнішні ІД OMIM: 602048 MGI: 97845 HomoloGene: 69035 GeneCards: RAC1
Пов'язані генетичні захворювання
autosomal dominant mental retardation 48[1]
Онтологія гена
Молекулярна функція

histone deacetylase binding
Rho GDP-dissociation inhibitor binding
GTP-dependent protein binding
GO:0006184 GTPase activity
enzyme binding
GO:0001948, GO:0016582 protein binding
thioesterase binding
protein kinase binding
nucleotide binding
GTP binding
protein serine/threonine kinase activity
GO:0032403 protein-containing complex binding
phosphatidylinositol-4,5-bisphosphate 3-kinase activity
ATPase binding

Клітинна компонента

цитоплазма
гіалоплазма
мембрана
focal adhesion
Меланосома
ruffle membrane
trans-Golgi network
клітинне ядро
cell projection
extrinsic component of plasma membrane
екзосома
lamellipodium
early endosome membrane
клітинна мембрана
мікрофіламент
cytoplasmic ribonucleoprotein granule
endoplasmic reticulum membrane
Golgi membrane
phagocytic cup
GO:0016023 cytoplasmic vesicle
GO:0005578 Позаклітинна матриця
secretory granule membrane
dendritic spine
recycling endosome membrane
postsynapse
glutamatergic synapse
ficolin-1-rich granule membrane

Біологічний процес

positive regulation of Rho protein signal transduction
regulation of respiratory burst
non-canonical Wnt signaling pathway
positive regulation of protein phosphorylation
positive regulation of actin filament polymerization
regulation of neuron maturation
negative regulation of receptor-mediated endocytosis
platelet activation
Fc-epsilon receptor signaling pathway
cellular response to mechanical stimulus
phagocytosis, engulfment
vascular endothelial growth factor receptor signaling pathway
substrate adhesion-dependent cell spreading
проліферація
ruffle assembly
lamellipodium assembly
dopaminergic neuron differentiation
cell-cell junction organization
Fc-gamma receptor signaling pathway involved in phagocytosis
ruffle organization
actin filament organization
cell motility
anatomical structure morphogenesis
кісткова резорбція
response to wounding
protein localization to plasma membrane
inflammatory response
regulation of small GTPase mediated signal transduction
positive regulation of cell-substrate adhesion
G protein-coupled receptor signaling pathway
neuron projection morphogenesis
epithelial cell morphogenesis
dendrite morphogenesis
regulation of hydrogen peroxide metabolic process
engulfment of apoptotic cell
dendrite development
auditory receptor cell morphogenesis
hyperosmotic response
cerebral cortex GABAergic interneuron development
хемотаксис
positive regulation of DNA replication
actin filament polymerization
адгезія клітин
negative regulation of interleukin-23 production
homeostasis of number of cells within a tissue
cell-matrix adhesion
localization within membrane
actin cytoskeleton organization
regulation of cell size
anatomical structure arrangement
GO:0007243 intracellular signal transduction
regulation of cell migration
ендоцитоз
ephrin receptor signaling pathway
T cell costimulation
зсідання крові
GO:0019049, GO:0030683 mitigation of host defenses by virus
synaptic transmission, GABAergic
mast cell chemotaxis
positive regulation of phosphatidylinositol 3-kinase activity
positive regulation of substrate adhesion-dependent cell spreading
embryonic olfactory bulb interneuron precursor migration
cytoskeleton organization
cochlea morphogenesis
positive regulation of neutrophil chemotaxis
positive regulation of apoptotic process
regulation of cell morphogenesis
positive regulation of focal adhesion assembly
regulation of fibroblast migration
positive regulation of lamellipodium assembly
cerebral cortex radially oriented cell migration
cell migration
semaphorin-plexin signaling pathway
positive regulation of stress fiber assembly
axon guidance
small GTPase mediated signal transduction
GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
Wnt signaling pathway, planar cell polarity pathway
midbrain dopaminergic neuron differentiation
neuron migration
protein phosphorylation
Rho protein signal transduction
regulation of lamellipodium assembly
Rac protein signal transduction
cell projection assembly
positive regulation of microtubule polymerization
neutrophil degranulation
regulation of nitric oxide biosynthetic process
phosphatidylinositol phosphate biosynthetic process
hepatocyte growth factor receptor signaling pathway
regulation of stress fiber assembly
positive regulation of protein kinase B signaling
motor neuron axon guidance
regulation of neutrophil migration
positive regulation of insulin secretion involved in cellular response to glucose stimulus

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
5879
19353
Ensembl
ENSG00000136238
ENSMUSG00000001847
UniProt
P63000
P63001
RefSeq (мРНК)
NM_198829
NM_006908
NM_018890
NM_009007
NM_001347530
RefSeq (білок)
NP_008839
NP_061485
NP_001334459
NP_033033
Локус (UCSC) Хр. 7: 6.37 – 6.4 Mb Хр. 5: 143.49 – 143.51 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RAC1 (англ. Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 192 амінокислот, а молекулярна маса — 21 450[5].

Послідовність амінокислот
1020304050
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP
VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE
VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIG
AVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

Література

  • Drivas G.T., Shih A., Coutavas E., Rush M.G., D'Eustachio P. (1990). Characterization of four novel ras-like genes expressed in a human teratocarcinoma cell line. Mol. Cell. Biol. 10: 1793—1798. PMID 2108320 DOI:10.1128/MCB.10.4.1793
  • Jordan P., Brazao R., Boavida M.G., Gespach C., Chastre E. (1999). Cloning of a novel human Rac1b splice variant with increased expression in colorectal tumors. Oncogene. 18: 6835—6839. PMID 10597294 DOI:10.1038/sj.onc.1203233
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Ridley A.J., Paterson H.F., Johnston C.L., Diekmann D., Hall A. (1992). The small GTP-binding protein rac regulates growth factor-induced membrane ruffling. Cell. 70: 401—410. PMID 1643658 DOI:10.1016/0092-8674(92)90164-8
  • Vincent S., Settleman J. (1997). The PRK2 kinase is a potential effector target of both Rho and Rac GTPases and regulates actin cytoskeletal organization. Mol. Cell. Biol. 17: 2247—2256. PMID 9121475 DOI:10.1128/MCB.17.4.2247
  • Ren Y., Li R., Zheng Y., Busch H. (1998). Cloning and characterization of GEF-H1, a microtubule-associated guanine nucleotide exchange factor for Rac and Rho GTPases. J. Biol. Chem. 273: 34954—34960. PMID 9857026 DOI:10.1074/jbc.273.52.34954

Примітки

  1. Захворювання, генетично пов'язані з RAC1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:9801 (англ.) . Процитовано 7 вересня 2017.
  5. UniProt, P63000 (англ.) . Архів оригіналу за 6 вересня 2017. Процитовано 7 вересня 2017.

Див. також

  • Хромосома 7
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.